Lineage for d2gx2e_ (2gx2 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940765Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2940774Domain d2gx2e_: 2gx2 E: [197985]
    automated match to d2gx2l_
    complexed with mg

Details for d2gx2e_

PDB Entry: 2gx2 (more details), 1.8 Å

PDB Description: Crystal structural and functional analysis of GFP-like fluorescent protein Dronpa
PDB Compounds: (E:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2gx2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gx2e_ d.22.1.0 (E:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr

SCOPe Domain Coordinates for d2gx2e_:

Click to download the PDB-style file with coordinates for d2gx2e_.
(The format of our PDB-style files is described here.)

Timeline for d2gx2e_: