| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries) |
| Domain d2gx2d_: 2gx2 D: [197984] automated match to d2gx2l_ complexed with mg |
PDB Entry: 2gx2 (more details), 1.8 Å
SCOPe Domain Sequences for d2gx2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gx2d_ d.22.1.0 (D:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
Timeline for d2gx2d_: