![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (17 species) not a true protein |
![]() | Species Echinophyllia sp. [TaxId:301887] [188534] (12 PDB entries) |
![]() | Domain d2gx0b_: 2gx0 B: [197979] automated match to d2gx0d_ |
PDB Entry: 2gx0 (more details), 1.9 Å
SCOPe Domain Sequences for d2gx0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gx0b_ d.22.1.0 (B:) automated matches {Echinophyllia sp. [TaxId: 301887]} svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
Timeline for d2gx0b_: