SCOPe 2.06: Domain d2gnuh2: 2gnu H:36-245

Lineage for d2gnuh2 (2gnu H:36-245)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein automated matches [226918] (3 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [225170] (7 PDB entries)

8. Domain d2gnuh2: 2gnu H:36-245 [197977]
   Other proteins in same PDB: d2gnuh1, d2gnul_, d2gnum_
   automated match to d1l9bh1
   complexed with bcl, bph, cdl, cl, fe2, lda, u10

Details for d2gnuh2

PDB Entry: 2gnu, 2.2 Å

PDB Description: The crystallization of reaction center from Rhodobacter sphaeroides occurs via a new route

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2gnuh2:

Sequence; same for both SEQRES and ATOM records:

>d2gnuh2 b.41.1.1 (H:36-245) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaa

Timeline for d2gnuh2:

• d2gnuh2 first appeared in SCOPe 2.03
  
• d2gnuh2 appears in SCOPe 2.05
  
• d2gnuh2 appears in SCOPe 2.07
  
• d2gnuh2 appears in the current release, SCOPe 2.08