Lineage for d2glvi_ (2glv I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551122Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2551123Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2551124Species Helicobacter pylori [TaxId:210] [188573] (17 PDB entries)
  8. 2551223Domain d2glvi_: 2glv I: [197971]
    automated match to d2glvl_
    complexed with cl; mutant

Details for d2glvi_

PDB Entry: 2glv (more details), 2.5 Å

PDB Description: crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase(fabz) mutant(y100a) from helicobacter pylori
PDB Compounds: (I:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d2glvi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glvi_ d.38.1.6 (I:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
vlivegmaqsggflaftslwgfdpeiaktkivafmtidkvkfripvtpgdrleyhlevlk
hkgmiwqvggtaqvdgkvvaeaelkamiaere

SCOPe Domain Coordinates for d2glvi_:

Click to download the PDB-style file with coordinates for d2glvi_.
(The format of our PDB-style files is described here.)

Timeline for d2glvi_: