SCOPe 2.01: Domain d1hinh1: 1hin H:1-112

Lineage for d1hinh1 (1hin H:1-112)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (53 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1hinh1: 1hin H:1-112 [19797]
   Other proteins in same PDB: d1hinh2, d1hinl1, d1hinl2
   part of Fab 17/9

Details for d1hinh1

PDB Entry: 1hin, 3.1 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody-antigen recognition

PDB Compounds: (H:) igg2a-kappa 17/9 fab (heavy chain)

SCOPe Domain Sequences for d1hinh1:

Sequence; same for both SEQRES and ATOM records:

>d1hinh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvs

Timeline for d1hinh1:

• d1hinh1 first appeared (with stable ids) in SCOP 1.55
  
• d1hinh1 appears in SCOP 1.75
  
• d1hinh1 appears in SCOPe 2.02
  
• d1hinh1 appears in the current release, SCOPe 2.08