Lineage for d2gllc_ (2gll C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902235Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 1902236Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 1902237Species Helicobacter pylori [TaxId:210] [188573] (15 PDB entries)
  8. 1902240Domain d2gllc_: 2gll C: [197960]
    automated match to d2gllf_
    complexed with ben, cl

Details for d2gllc_

PDB Entry: 2gll (more details), 2.2 Å

PDB Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(FabZ) from Helicobacter pylori
PDB Compounds: (C:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d2gllc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gllc_ d.38.1.6 (C:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
kgmiwqvggtaqvdgkvvaeaelkamiaere

SCOPe Domain Coordinates for d2gllc_:

Click to download the PDB-style file with coordinates for d2gllc_.
(The format of our PDB-style files is described here.)

Timeline for d2gllc_: