SCOP 1.65: Domain d1hinl1: 1hin L:1-108

Lineage for d1hinl1 (1hin L:1-108)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (22 PDB entries)

8. Domain d1hinl1: 1hin L:1-108 [19796]
   Other proteins in same PDB: d1hinh1, d1hinh2, d1hinl2
   part of Fab 17/9

Details for d1hinl1

PDB Entry: 1hin, 3.1 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody-antigen recognition

SCOP Domain Sequences for d1hinl1:

Sequence; same for both SEQRES and ATOM records:

>d1hinl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkr

Timeline for d1hinl1:

• d1hinl1 first appeared (with stable ids) in SCOP 1.55
  
• d1hinl1 appears in SCOP 1.63
  
• d1hinl1 appears in SCOP 1.67
  
• d1hinl1 appears in the current release, SCOPe 2.08