![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
![]() | Protein automated matches [190782] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188028] (9 PDB entries) |
![]() | Domain d2gixa_: 2gix A: [197954] automated match to d2gixd_ complexed with k, mpd; mutant |
PDB Entry: 2gix (more details), 2.02 Å
SCOPe Domain Sequences for d2gixa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gixa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} shgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlve ahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlsk qdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrf hktyevpntplcsardlaekkyilsn
Timeline for d2gixa_: