| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
| Protein automated matches [190782] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries) |
| Domain d2gixa1: 2gix A:44-370 [197954] Other proteins in same PDB: d2gixa2, d2gixb2, d2gixc2, d2gixd2 automated match to d2gixd_ complexed with k, mpd; mutant |
PDB Entry: 2gix (more details), 2.02 Å
SCOPe Domain Sequences for d2gixa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gixa1 b.1.18.16 (A:44-370) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlveahv
raqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlskqdi
dnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrfhkt
yevpntplcsardlaekkyilsn
Timeline for d2gixa1: