SCOPe 2.05: Domain d2geyd_: 2gey D:

Lineage for d2geyd_ (2gey D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)

6. Protein Putative hydroxylase AclR [159969] (1 species)

7. Species Streptomyces galilaeus [TaxId:33899] [159970] (1 PDB entry)
   Uniprot Q1XDX7 2-145

8. Domain d2geyd_: 2gey D: [197951]
   automated match to d2geya1
   complexed with gol, peg, pg4

Details for d2geyd_

PDB Entry: 2gey, 1.8 Å

PDB Description: Crystal Structure of AclR a putative hydroxylase from Streptomyces galilaeus

PDB Compounds: (D:) AclR protein

SCOPe Domain Sequences for d2geyd_:

Sequence; same for both SEQRES and ATOM records:

>d2geyd_ d.17.4.9 (D:) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]}
smaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpdl
qlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdvi
nmrpllvrlgklp

Timeline for d2geyd_:

• d2geyd_ first appeared in SCOPe 2.03
  
• d2geyd_ appears in SCOPe 2.04
  
• d2geyd_ appears in SCOPe 2.06
  
• d2geyd_ appears in the current release, SCOPe 2.08