Lineage for d1himj1 (1him J:1-108)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354061Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries)
  8. 2354125Domain d1himj1: 1him J:1-108 [19795]
    Other proteins in same PDB: d1himh2, d1himj2, d1himl1, d1himl2, d1himm1, d1himm2
    part of Fab 17/9; chain identifiers are mixed up

Details for d1himj1

PDB Entry: 1him (more details), 2.9 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition
PDB Compounds: (J:) igg2a-kappa 17/9 fab (light chain)

SCOPe Domain Sequences for d1himj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1himj1 b.1.1.1 (J:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkr

SCOPe Domain Coordinates for d1himj1:

Click to download the PDB-style file with coordinates for d1himj1.
(The format of our PDB-style files is described here.)

Timeline for d1himj1: