Lineage for d1himj1 (1him J:1-112)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102354Species Fab 17/9 (mouse), kappa L chain [48757] (4 PDB entries)
  8. 102362Domain d1himj1: 1him J:1-112 [19795]
    Other proteins in same PDB: d1himh2, d1himj2, d1himl2, d1himm2

Details for d1himj1

PDB Entry: 1him (more details), 2.9 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition

SCOP Domain Sequences for d1himj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1himj1 b.1.1.1 (J:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaa

SCOP Domain Coordinates for d1himj1:

Click to download the PDB-style file with coordinates for d1himj1.
(The format of our PDB-style files is described here.)

Timeline for d1himj1: