SCOPe 2.08: Domain d2gbwe2: 2gbw E:153-454

Lineage for d2gbwe2 (2gbw E:153-454)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Sphingobium yanoikuyae [TaxId:13690] [225237] (2 PDB entries)

8. Domain d2gbwe2: 2gbw E:153-454 [197943]
   Other proteins in same PDB: d2gbwa1, d2gbwb_, d2gbwc1, d2gbwd_, d2gbwe1, d2gbwf_
   automated match to d1eg9a2
   complexed with fe, fes, oxy

Details for d2gbwe2

PDB Entry: 2gbw, 1.7 Å

PDB Description: crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1

PDB Compounds: (E:) Biphenyl 2,3-Dioxygenase Alpha Subunit

SCOPe Domain Sequences for d2gbwe2:

Sequence; same for both SEQRES and ATOM records:

>d2gbwe2 d.129.3.0 (E:153-454) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
eapsledylgefryyldtiwegagggmellgppmksllqcnwkvpaenfigdgyhvgwth
aaalsqiggelaglagnradipfddlglqfttrhghgfgvidnaaaglhikregwtkfle
dtrgevrrkfgpererlylghwncsifpncsflygtntfkiwhprgpheievwtytivpr
dadpatksmiqreairtfgtagtlesddgenmssatyinrgvitrngrmnstmgvgyegp
hpvypgivgisfigetsyrgfyrfwkemidapdwasvkanddtwdsvfpnrnfwneklna
ae

Timeline for d2gbwe2:

• d2gbwe2 first appeared in SCOPe 2.03
  
• d2gbwe2 appears in SCOPe 2.07