Lineage for d2gbwe1 (2gbw E:6-152)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. 2782712Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries)
  8. 2782715Domain d2gbwe1: 2gbw E:6-152 [197942]
    Other proteins in same PDB: d2gbwa2, d2gbwb_, d2gbwc2, d2gbwd_, d2gbwe2, d2gbwf_
    automated match to d1o7na1
    complexed with fe, fes, oxy

Details for d2gbwe1

PDB Entry: 2gbw (more details), 1.7 Å

PDB Description: crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1
PDB Compounds: (E:) Biphenyl 2,3-Dioxygenase Alpha Subunit

SCOPe Domain Sequences for d2gbwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbwe1 b.33.1.0 (E:6-152) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
tlvdtvnasqsrqvfwdedvyaleierifsrawlmlgheslvpkpgdfittymaedkvil
shqsdgtfrafinscshrgnqichadsgnakafvcnyhgwvfgqdgslvdvplesrcyhn
sldkqklaaksvrvetykgfifgchdp

SCOPe Domain Coordinates for d2gbwe1:

Click to download the PDB-style file with coordinates for d2gbwe1.
(The format of our PDB-style files is described here.)

Timeline for d2gbwe1: