![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (18 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries) |
![]() | Domain d2g60l1: 2g60 L:1-108 [197936] Other proteins in same PDB: d2g60h2, d2g60h3, d2g60l2 automated match to d2jell1 |
PDB Entry: 2g60 (more details), 1.85 Å
SCOPe Domain Sequences for d2g60l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g60l1 b.1.1.1 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvlmtqapltlpvslgdqasiscrssqaivhangntylewylqkpgqspalliykvanrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgahapytfgggtkleikr
Timeline for d2g60l1: