SCOPe 2.08: Domain d2fkpc1: 2fkp C:6-132

Lineage for d2fkpc1 (2fkp C:6-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein N-acylamino acid racemase [110937] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110939] (5 PDB entries)
   Uniprot Q9RYA6

8. Domain d2fkpc1: 2fkp C:6-132 [197921]
   Other proteins in same PDB: d2fkpa1, d2fkpb2, d2fkpc2, d2fkpd2
   automated match to d2fkpa2
   mutant

Details for d2fkpc1

PDB Entry: 2fkp, 2 Å

PDB Description: the mutant g127c-t313c of deinococcus radiodurans n-acylamino acid racemase

PDB Compounds: (C:) N-acylamino acid racemase

SCOPe Domain Sequences for d2fkpc1:

Sequence, based on SEQRES records:

>d2fkpc1 d.54.1.1 (C:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lctllgg

Sequence, based on observed residues (ATOM records):

>d2fkpc1 d.54.1.1 (C:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplctllgg

Timeline for d2fkpc1:

• d2fkpc1 first appeared in SCOPe 2.03
  
• d2fkpc1 appears in SCOPe 2.07