| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (16 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
| Domain d2fjgl2: 2fjg L:108-211 [197917] Other proteins in same PDB: d2fjga1, d2fjgb1, d2fjgb2, d2fjgh1, d2fjgh2, d2fjgl1, d2fjgv_, d2fjgw_ automated match to d1rhha2 complexed with so4 |
PDB Entry: 2fjg (more details), 2.8 Å
SCOPe Domain Sequences for d2fjgl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjgl2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d2fjgl2: