Lineage for d2fjfo2 (2fjf O:108-211)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029857Domain d2fjfo2: 2fjf O:108-211 [197905]
    Other proteins in same PDB: d2fjfa1, d2fjfb1, d2fjfb2, d2fjfc1, d2fjfd1, d2fjfd2, d2fjfe1, d2fjff1, d2fjff2, d2fjfg1, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj1, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfm1, d2fjfn1, d2fjfn2, d2fjfo1, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfr1, d2fjfr2, d2fjfs1, d2fjft1, d2fjft2, d2fjfu1, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfx1, d2fjfx2
    automated match to d1rhha2

Details for d2fjfo2

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (O:) Light Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjfo2 b.1.1.2 (O:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2fjfo2:

Click to download the PDB-style file with coordinates for d2fjfo2.
(The format of our PDB-style files is described here.)

Timeline for d2fjfo2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fjfo1
View in 3D
Domains from other chains:
(mouse over for more information)
d2fjfa1, d2fjfa2, d2fjfb1, d2fjfb2, d2fjfc1, d2fjfc2, d2fjfd1, d2fjfd2, d2fjfe1, d2fjfe2, d2fjff1, d2fjff2, d2fjfg1, d2fjfg2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj1, d2fjfj2, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2