![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
![]() | Domain d2fjfj2: 2fjf J:108-211 [197899] Other proteins in same PDB: d2fjfa1, d2fjfb1, d2fjfb2, d2fjfc1, d2fjfd1, d2fjfd2, d2fjfe1, d2fjff1, d2fjff2, d2fjfg1, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj1, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfm1, d2fjfn1, d2fjfn2, d2fjfo1, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfr1, d2fjfr2, d2fjfs1, d2fjft1, d2fjft2, d2fjfu1, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfx1, d2fjfx2 automated match to d1rhha2 |
PDB Entry: 2fjf (more details), 2.65 Å
SCOPe Domain Sequences for d2fjfj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjfj2 b.1.1.2 (J:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d2fjfj2:
![]() Domains from other chains: (mouse over for more information) d2fjfa1, d2fjfa2, d2fjfb1, d2fjfb2, d2fjfc1, d2fjfc2, d2fjfd1, d2fjfd2, d2fjfe1, d2fjfe2, d2fjff1, d2fjff2, d2fjfg1, d2fjfg2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfo1, d2fjfo2, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2 |