![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
![]() | Domain d2fjfe1: 2fjf E:1-107 [197894] Other proteins in same PDB: d2fjfa2, d2fjfb1, d2fjfb2, d2fjfc2, d2fjfd1, d2fjfd2, d2fjfe2, d2fjff1, d2fjff2, d2fjfg2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj2, d2fjfk1, d2fjfk2, d2fjfl2, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfo2, d2fjfp1, d2fjfp2, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs2, d2fjft1, d2fjft2, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw2, d2fjfx1, d2fjfx2 automated match to d1rhha1 |
PDB Entry: 2fjf (more details), 2.65 Å
SCOPe Domain Sequences for d2fjfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjfe1 b.1.1.0 (E:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik
Timeline for d2fjfe1:
![]() Domains from other chains: (mouse over for more information) d2fjfa1, d2fjfa2, d2fjfb1, d2fjfb2, d2fjfc1, d2fjfc2, d2fjfd1, d2fjfd2, d2fjff1, d2fjff2, d2fjfg1, d2fjfg2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj1, d2fjfj2, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfo1, d2fjfo2, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjft1, d2fjft2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2 |