SCOPe 2.06: Domain d2fepa_: 2fep A:

Lineage for d2fepa_ (2fep A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (70 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226286] (2 PDB entries)

8. Domain d2fepa_: 2fep A: [197889]
   Other proteins in same PDB: d2feps_
   automated match to d4kmra_
   complexed with so4

Details for d2fepa_

PDB Entry: 2fep, 2.45 Å

PDB Description: Structure of truncated CcpA in complex with P-Ser-HPr and Sulfate ions

PDB Compounds: (A:) Catabolite control protein A

SCOPe Domain Sequences for d2fepa_:

Sequence; same for both SEQRES and ATOM records:

>d2fepa_ c.93.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tttvgviipdissifyselargiediatmykyniilsnsdqnmekelhllntmlgkqvdg
ivfmggnitdehvaefkrspvpivlaasveeqeetpsvaidyeqaiydavkllvdkghtd
iafvsgpmaepinrskklqgykraleeanlpfneqfvaegdytydsglealqhlmsldkk
ptailsatdemalgiihaaqdqglsipedldiigfdntrlslmvrpqlstvvqptydiga
vamrlltklmnkepveehivelphrielrkstk

Timeline for d2fepa_:

• d2fepa_ first appeared in SCOPe 2.03
  
• d2fepa_ appears in SCOPe 2.05
  
• d2fepa_ appears in SCOPe 2.07
  
• d2fepa_ appears in the current release, SCOPe 2.08