Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d2f9bl1: 2f9b L:49-86 [197887] Other proteins in same PDB: d2f9bh_, d2f9bt1, d2f9bt2 automated match to d1danl1 complexed with n1h |
PDB Entry: 2f9b (more details), 2.54 Å
SCOPe Domain Sequences for d2f9bl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9bl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} qcasspcqnggsckdqlqsyicfclpafegrncethkd
Timeline for d2f9bl1: