Lineage for d2f9bl1 (2f9b L:49-86)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258104Protein Coagulation factor VIIa [57201] (1 species)
  7. 2258105Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2258203Domain d2f9bl1: 2f9b L:49-86 [197887]
    Other proteins in same PDB: d2f9bh_, d2f9bt1, d2f9bt2
    automated match to d1danl1
    complexed with n1h

Details for d2f9bl1

PDB Entry: 2f9b (more details), 2.54 Å

PDB Description: discovery of novel heterocyclic factor viia inhibitors
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2f9bl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9bl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d2f9bl1:

Click to download the PDB-style file with coordinates for d2f9bl1.
(The format of our PDB-style files is described here.)

Timeline for d2f9bl1: