![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family) ![]() |
![]() | Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein) |
![]() | Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [63865] (2 PDB entries) |
![]() | Domain d2f17b2: 2f17 B:159-243 [197886] Other proteins in same PDB: d2f17a2, d2f17a3, d2f17b1 automated match to d1ig3a1 complexed with amp, epe, mg, pyi, so4 |
PDB Entry: 2f17 (more details), 2.5 Å
SCOPe Domain Sequences for d2f17b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f17b2 b.82.6.1 (B:159-243) Thiamin pyrophosphokinase, substrate-binding domain {Mouse (Mus musculus) [TaxId: 10090]} dsliyllqpgkhrlhvdtgmegswcglipvgqpcnqvtttglkwnltndvlgfgtlvsts ntydgsglvtvetdhpllwtmaiks
Timeline for d2f17b2: