SCOPe 2.07: Domain d2f17b1: 2f17 B:1-158

Lineage for d2f17b1 (2f17 B:1-158)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.100: Thiamin pyrophosphokinase, catalytic domain [63998] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 432156

4. Superfamily c.100.1: Thiamin pyrophosphokinase, catalytic domain [63999] (1 family)

5. Family c.100.1.1: Thiamin pyrophosphokinase, catalytic domain [64000] (1 protein)

6. Protein Thiamin pyrophosphokinase, catalytic domain [64001] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64002] (2 PDB entries)

8. Domain d2f17b1: 2f17 B:1-158 [197885]
   Other proteins in same PDB: d2f17a1, d2f17a3, d2f17b2
   automated match to d1ig3a2
   complexed with amp, epe, mg, pyi, so4

Details for d2f17b1

PDB Entry: 2f17, 2.5 Å

PDB Description: Mouse Thiamin Pyrophosphokinase in a Ternary Complex with Pyrithiamin Pyrophosphate and AMP at 2.5 angstrom

PDB Compounds: (B:) Thiamin pyrophosphokinase 1

SCOPe Domain Sequences for d2f17b1:

Sequence; same for both SEQRES and ATOM records:

>d2f17b1 c.100.1.1 (B:1-158) Thiamin pyrophosphokinase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}
mehaftplepllptgnlkyclvvlnqpldarfrhlwkkallracadgganhlydlteger
esflpefvsgdfdsirpevkeyytkkgcdlistpdqdhtdftkclqvlqrkieekelqvd
vivtlgglggrfdqimasvntlfqathitpvpiiiiqk

Timeline for d2f17b1:

• d2f17b1 first appeared in SCOPe 2.03
  
• d2f17b1 appears in SCOPe 2.06
  
• d2f17b1 appears in the current release, SCOPe 2.08