![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein automated matches [190043] (8 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries) |
![]() | Domain d2eswa1: 2esw A:5-61 [197884] Other proteins in same PDB: d2eswa2 automated match to d2eswb_ complexed with cl, hg |
PDB Entry: 2esw (more details), 2.01 Å
SCOPe Domain Sequences for d2eswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eswa1 b.34.2.1 (A:5-61) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei
Timeline for d2eswa1: