SCOPe 2.08: Domain d2eizb1: 2eiz B:6-113

Lineage for d2eizb1 (2eiz B:6-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2eizb1: 2eiz B:6-113 [197881]
   Other proteins in same PDB: d2eiza_, d2eizb2, d2eizc_
   automated match to d4aq1b_
   mutant

Details for d2eizb1

PDB Entry: 2eiz, 1.9 Å

PDB Description: Crystal structure of humanized HYHEL-10 fv mutant(HW47Y)-hen lysozyme complex

PDB Compounds: (B:) anti-lysozyme antibody fv region

SCOPe Domain Sequences for d2eizb1:

Sequence; same for both SEQRES and ATOM records:

>d2eizb1 b.1.1.0 (B:6-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglmkpsetlsltcsvsgdsirsdywswirqppgkgleyigyvsysgstyynpslks
rvtisvdtsknrfslklnsvtaadtavyycarwdgdywgqgilvtvss

Timeline for d2eizb1:

• d2eizb1 first appeared in SCOPe 2.03, called d2eizb_
  
• d2eizb1 appears in SCOPe 2.07