Lineage for d2eigc_ (2eig C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781169Species Lotus tetragonolobus [TaxId:3868] [188358] (1 PDB entry)
  8. 2781172Domain d2eigc_: 2eig C: [197880]
    automated match to d2eigd_
    complexed with ca, mn, nag

Details for d2eigc_

PDB Entry: 2eig (more details), 2 Å

PDB Description: lotus tetragonolobus seed lectin (isoform)
PDB Compounds: (C:) lectin

SCOPe Domain Sequences for d2eigc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eigc_ b.29.1.0 (C:) automated matches {Lotus tetragonolobus [TaxId: 3868]}
vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkep

SCOPe Domain Coordinates for d2eigc_:

Click to download the PDB-style file with coordinates for d2eigc_.
(The format of our PDB-style files is described here.)

Timeline for d2eigc_: