| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Lotus tetragonolobus [TaxId:3868] [188358] (1 PDB entry) |
| Domain d2eiga_: 2eig A: [197878] automated match to d2eigd_ complexed with ca, mn, nag |
PDB Entry: 2eig (more details), 2 Å
SCOPe Domain Sequences for d2eiga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eiga_ b.29.1.0 (A:) automated matches {Lotus tetragonolobus [TaxId: 3868]}
vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkep
Timeline for d2eiga_: