Lineage for d2eiga_ (2eig A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (57 species)
    not a true protein
  7. 2375515Species Lotus tetragonolobus [TaxId:3868] [188358] (1 PDB entry)
  8. 2375516Domain d2eiga_: 2eig A: [197878]
    automated match to d2eigd_
    complexed with ca, mn, nag

Details for d2eiga_

PDB Entry: 2eig (more details), 2 Å

PDB Description: lotus tetragonolobus seed lectin (isoform)
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2eiga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiga_ b.29.1.0 (A:) automated matches {Lotus tetragonolobus [TaxId: 3868]}
vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkep

SCOPe Domain Coordinates for d2eiga_:

Click to download the PDB-style file with coordinates for d2eiga_.
(The format of our PDB-style files is described here.)

Timeline for d2eiga_: