Lineage for d2e2mi_ (2e2m I:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118053Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2118396Protein automated matches [190100] (19 species)
    not a true protein
  7. 2118405Species Aeropyrum pernix [TaxId:272557] [186846] (8 PDB entries)
  8. 2118483Domain d2e2mi_: 2e2m I: [197876]
    automated match to d2e2ga_

Details for d2e2mi_

PDB Entry: 2e2m (more details), 2.6 Å

PDB Description: Crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from Aeropyrum pernix K1 (sulfinic acid form)
PDB Compounds: (I:) Probable peroxiredoxin

SCOPe Domain Sequences for d2e2mi_:

Sequence, based on SEQRES records: (download)

>d2e2mi_ c.47.1.10 (I:) automated matches {Aeropyrum pernix [TaxId: 272557]}
sipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryed
fqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesath
tvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiige
glivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllye
e

Sequence, based on observed residues (ATOM records): (download)

>d2e2mi_ c.47.1.10 (I:) automated matches {Aeropyrum pernix [TaxId: 272557]}
sipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryed
fqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllathtvrg
vfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigegliv
pppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllyee

SCOPe Domain Coordinates for d2e2mi_:

Click to download the PDB-style file with coordinates for d2e2mi_.
(The format of our PDB-style files is described here.)

Timeline for d2e2mi_: