SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2e2ma_ (2e2m A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118053Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2118396Protein automated matches [190100] (19 species)
    not a true protein
  7. 2118405Species Aeropyrum pernix [TaxId:272557] [186846] (8 PDB entries)
  8. 2118475Domain d2e2ma_: 2e2m A: [197868]
    automated match to d2e2ga_

Details for d2e2ma_

PDB Entry: 2e2m (more details), 2.6 Å

PDB Description: Crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from Aeropyrum pernix K1 (sulfinic acid form)
PDB Compounds: (A:) Probable peroxiredoxin

SCOPe Domain Sequences for d2e2ma_:

Sequence, based on SEQRES records: (download)

>d2e2ma_ c.47.1.10 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
sipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryed
fqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesath
tvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiige
glivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllye

Sequence, based on observed residues (ATOM records): (download)

>d2e2ma_ c.47.1.10 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
sipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryed
fqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllathtvrg
vfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigegliv
pppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllye

SCOPe Domain Coordinates for d2e2ma_:

Click to download the PDB-style file with coordinates for d2e2ma_.
(The format of our PDB-style files is described here.)

Timeline for d2e2ma_: