Lineage for d1hila1 (1hil A:1-108)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7343Species Fab 17/9 (mouse), kappa L chain [48757] (4 PDB entries)
  8. 7344Domain d1hila1: 1hil A:1-108 [19786]
    Other proteins in same PDB: d1hila2, d1hilb2, d1hilc2, d1hild2

Details for d1hila1

PDB Entry: 1hil (more details), 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

SCOP Domain Sequences for d1hila1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hila1 b.1.1.1 (A:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkr

SCOP Domain Coordinates for d1hila1:

Click to download the PDB-style file with coordinates for d1hila1.
(The format of our PDB-style files is described here.)

Timeline for d1hila1: