Lineage for d2dtml2 (2dtm L:108-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (522 PDB entries)
  8. 2354030Domain d2dtml2: 2dtm L:108-213 [197859]
    Other proteins in same PDB: d2dtmh1, d2dtml1
    automated match to d1blna2

Details for d2dtml2

PDB Entry: 2dtm (more details), 2.25 Å

PDB Description: Thermodynamic and structural analyses of hydrolytic mechanism by catalytic antibodies
PDB Compounds: (L:) immunoglobulin 6d9

SCOPe Domain Sequences for d2dtml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtml2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d2dtml2:

Click to download the PDB-style file with coordinates for d2dtml2.
(The format of our PDB-style files is described here.)

Timeline for d2dtml2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dtml1
View in 3D
Domains from other chains:
(mouse over for more information)
d2dtmh1