SCOPe 2.06: Domain d2dfkc2: 2dfk C:240-397

Lineage for d2dfkc2 (2dfk C:240-397)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Rho guanine nucleotide exchange factor 9, Collybistin [159209] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159210] (1 PDB entry)
   Uniprot Q9QX73 300-461

8. Domain d2dfkc2: 2dfk C:240-397 [197853]
   Other proteins in same PDB: d2dfka1, d2dfkb_, d2dfkc1, d2dfkd2, d2dfkd3
   automated match to d2dfka2
   complexed with gol, so4

Details for d2dfkc2

PDB Entry: 2dfk, 2.15 Å

PDB Description: Crystal structure of the CDC42-Collybistin II complex

PDB Compounds: (C:) collybistin II

SCOPe Domain Sequences for d2dfkc2:

Sequence; same for both SEQRES and ATOM records:

>d2dfkc2 b.55.1.1 (C:240-397) Rho guanine nucleotide exchange factor 9, Collybistin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nidkiaqwqasvldwegddildrsseliytgemawiyqpygrnqqrvfflfdhqmvlckk
dlirrdilyykgridmdkyevidiedgrdddfnvsmknafklhnketeevhlffakklee
kirwlrafreerkmvqedekigfeisenqkrqaamtvr

Timeline for d2dfkc2:

• d2dfkc2 first appeared in SCOPe 2.03
  
• d2dfkc2 appears in SCOPe 2.05
  
• d2dfkc2 appears in SCOPe 2.07
  
• d2dfkc2 appears in the current release, SCOPe 2.08