Lineage for d2dfkc2 (2dfk C:240-397)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803277Protein Rho guanine nucleotide exchange factor 9, Collybistin [159209] (1 species)
  7. 2803278Species Norway rat (Rattus norvegicus) [TaxId:10116] [159210] (1 PDB entry)
    Uniprot Q9QX73 300-461
  8. 2803280Domain d2dfkc2: 2dfk C:240-397 [197853]
    Other proteins in same PDB: d2dfka1, d2dfkb_, d2dfkc1, d2dfkd2, d2dfkd3
    automated match to d2dfka2
    complexed with gol, so4

    has additional insertions and/or extensions that are not grouped together

Details for d2dfkc2

PDB Entry: 2dfk (more details), 2.15 Å

PDB Description: Crystal structure of the CDC42-Collybistin II complex
PDB Compounds: (C:) collybistin II

SCOPe Domain Sequences for d2dfkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfkc2 b.55.1.1 (C:240-397) Rho guanine nucleotide exchange factor 9, Collybistin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nidkiaqwqasvldwegddildrsseliytgemawiyqpygrnqqrvfflfdhqmvlckk
dlirrdilyykgridmdkyevidiedgrdddfnvsmknafklhnketeevhlffakklee
kirwlrafreerkmvqedekigfeisenqkrqaamtvr

SCOPe Domain Coordinates for d2dfkc2:

Click to download the PDB-style file with coordinates for d2dfkc2.
(The format of our PDB-style files is described here.)

Timeline for d2dfkc2: