Lineage for d2dfkc1 (2dfk C:45-239)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740983Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 1740984Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 1740985Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 1741028Protein Rho guanine nucleotide exchange factor 9, Collybistin [158679] (1 species)
  7. 1741029Species Norway rat (Rattus norvegicus) [TaxId:10116] [158680] (1 PDB entry)
    Uniprot Q9QX73 97-299
  8. 1741031Domain d2dfkc1: 2dfk C:45-239 [197852]
    Other proteins in same PDB: d2dfka2, d2dfkb_, d2dfkc2, d2dfkd_
    automated match to d2dfka1
    complexed with gol, so4

Details for d2dfkc1

PDB Entry: 2dfk (more details), 2.15 Å

PDB Description: Crystal structure of the CDC42-Collybistin II complex
PDB Compounds: (C:) collybistin II

SCOPe Domain Sequences for d2dfkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfkc1 a.87.1.1 (C:45-239) Rho guanine nucleotide exchange factor 9, Collybistin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qnrdqmranvineimsterhyikhlkdicegylkqcrkrrdmfsdeqlkvifgniediyr
fqmgfvrdlekqynnddphlseigpcflehqdgfwiyseycnnhldacmelsklmkdsry
qhffeacrllqqmidiaidgflltpvqkickyplqlaellkytaqdhsdyryvaaalavm
rnvtqqinerkrrle

SCOPe Domain Coordinates for d2dfkc1:

Click to download the PDB-style file with coordinates for d2dfkc1.
(The format of our PDB-style files is described here.)

Timeline for d2dfkc1: