SCOPe 2.08: Domain d2deca_: 2dec A:

Lineage for d2deca_ (2dec A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (18 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [193200] (3 PDB entries)

8. Domain d2deca_: 2dec A: [197851]
   automated match to d2decb_
   complexed with edo, na

Details for d2deca_

PDB Entry: 2dec, 1.7 Å

PDB Description: Crystal Structure of the PH0510 protein from Pyrococcus horikoshii OT3

PDB Compounds: (A:) 325aa long hypothetical protein

SCOPe Domain Sequences for d2deca_:

Sequence; same for both SEQRES and ATOM records:

>d2deca_ c.80.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mktlieikqtpdgiikadkvfnkvkdkislpnrilylgcgsshflskllamvtnmhgglg
ialpcseflysketypigevelavgisrsgetteillalekinvkklgittressltrmc
dyslvvpaieesvvmthsftsfyfaylqllrysyglpplnageiskateksleyeryire
ivesfdfqniiflgsgllypvaleaslkmkemsifwseayptfevrhgfkaiadektlvv
lmveepfewheklvkefknqgakvlvisnspqdlgqdysielprlskdanpipylpivql
lsyykavsrglnpdnprfldkvvrw

Timeline for d2deca_:

• d2deca_ first appeared in SCOPe 2.03
  
• d2deca_ appears in SCOPe 2.07