Lineage for d2deca_ (2dec A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908303Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2908304Protein automated matches [190547] (18 species)
    not a true protein
  7. 2908384Species Pyrococcus horikoshii OT3 [TaxId:70601] [193200] (3 PDB entries)
  8. 2908387Domain d2deca_: 2dec A: [197851]
    automated match to d2decb_
    complexed with edo, na

Details for d2deca_

PDB Entry: 2dec (more details), 1.7 Å

PDB Description: Crystal Structure of the PH0510 protein from Pyrococcus horikoshii OT3
PDB Compounds: (A:) 325aa long hypothetical protein

SCOPe Domain Sequences for d2deca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2deca_ c.80.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mktlieikqtpdgiikadkvfnkvkdkislpnrilylgcgsshflskllamvtnmhgglg
ialpcseflysketypigevelavgisrsgetteillalekinvkklgittressltrmc
dyslvvpaieesvvmthsftsfyfaylqllrysyglpplnageiskateksleyeryire
ivesfdfqniiflgsgllypvaleaslkmkemsifwseayptfevrhgfkaiadektlvv
lmveepfewheklvkefknqgakvlvisnspqdlgqdysielprlskdanpipylpivql
lsyykavsrglnpdnprfldkvvrw

SCOPe Domain Coordinates for d2deca_:

Click to download the PDB-style file with coordinates for d2deca_.
(The format of our PDB-style files is described here.)

Timeline for d2deca_: