SCOPe 2.08: Domain d2ddql1: 2ddq L:1-112

Lineage for d2ddql1 (2ddq L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2ddql1: 2ddq L:1-112 [197849]
   Other proteins in same PDB: d2ddql2
   automated match to d1blna1
   complexed with epe, hrb

Details for d2ddql1

PDB Entry: 2ddq, 2.35 Å

PDB Description: Crystal Structure of the Fab fragment of a R310 antibody complexed with (R)-HNE-histidine adduct

PDB Compounds: (L:) R310 antibody light chain

SCOPe Domain Sequences for d2ddql1:

Sequence; same for both SEQRES and ATOM records:

>d2ddql1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelk

Timeline for d2ddql1:

• d2ddql1 first appeared in SCOPe 2.03
  
• d2ddql1 appears in SCOPe 2.07