Lineage for d2d03l2 (2d03 L:115-218)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520618Domain d2d03l2: 2d03 L:115-218 [197848]
    Other proteins in same PDB: d2d03h1, d2d03l1
    automated match to d2jell2
    complexed with gol, mes, peg; mutant

Details for d2d03l2

PDB Entry: 2d03 (more details), 1.97 Å

PDB Description: Crystal structure of the G91S mutant of the NNA7 Fab
PDB Compounds: (L:) anti-glycophorin A type N immunoglobulin light chain

SCOPe Domain Sequences for d2d03l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d03l2 b.1.1.0 (L:115-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d2d03l2:

Click to download the PDB-style file with coordinates for d2d03l2.
(The format of our PDB-style files is described here.)

Timeline for d2d03l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d03l1
View in 3D
Domains from other chains:
(mouse over for more information)
d2d03h1