SCOPe 2.08: Domain d2d03l2: 2d03 L:115-218

Lineage for d2d03l2 (2d03 L:115-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2d03l2: 2d03 L:115-218 [197848]
   Other proteins in same PDB: d2d03h_, d2d03l1
   automated match to d2jell2
   complexed with gol, mes, peg; mutant

Details for d2d03l2

PDB Entry: 2d03, 1.97 Å

PDB Description: Crystal structure of the G91S mutant of the NNA7 Fab

PDB Compounds: (L:) anti-glycophorin A type N immunoglobulin light chain

SCOPe Domain Sequences for d2d03l2:

Sequence; same for both SEQRES and ATOM records:

>d2d03l2 b.1.1.0 (L:115-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d2d03l2:

• d2d03l2 first appeared in SCOPe 2.03
  
• d2d03l2 appears in SCOPe 2.07