Lineage for d2d03l1 (2d03 L:2-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744307Domain d2d03l1: 2d03 L:2-114 [197847]
    Other proteins in same PDB: d2d03l2
    automated match to d2jell1
    complexed with gol, mes, peg; mutant

Details for d2d03l1

PDB Entry: 2d03 (more details), 1.97 Å

PDB Description: Crystal structure of the G91S mutant of the NNA7 Fab
PDB Compounds: (L:) anti-glycophorin A type N immunoglobulin light chain

SCOPe Domain Sequences for d2d03l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d03l1 b.1.1.1 (L:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqsplslpvslgdqasiscrssqslvhssgntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftltisrveaedlgvyycfqsshvpltfgagtklelkr

SCOPe Domain Coordinates for d2d03l1:

Click to download the PDB-style file with coordinates for d2d03l1.
(The format of our PDB-style files is described here.)

Timeline for d2d03l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d03l2
View in 3D
Domains from other chains:
(mouse over for more information)
d2d03h_