Lineage for d2cu0b1 (2cu0 B:3-95,B:207-478)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080657Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2080658Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2080675Species Pyrococcus horikoshii [TaxId:53953] [159379] (1 PDB entry)
    Uniprot O58045 3-96,207-480
  8. 2080677Domain d2cu0b1: 2cu0 B:3-95,B:207-478 [197845]
    automated match to d2cu0a1
    complexed with xmp

Details for d2cu0b1

PDB Entry: 2cu0 (more details), 2.1 Å

PDB Description: Crystal structure of inosine-5'-monophosphate dehydrogenase from Pyrococcus horikoshii OT3
PDB Compounds: (B:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d2cu0b1:

Sequence, based on SEQRES records: (download)

>d2cu0b1 c.1.5.1 (B:3-95,B:207-478) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]}
kfveklekaikgytfddvllipqatevepkdvdvstritpnvklnipilsaamdtvtewe
mavamaregglgvihrnmgieeqveqvkrvkraXkyknavrdengellvaaavspfdikr
aieldkagvdvivvdtahahnlkaiksmkemrqkvdadfivgnianpkavddltfadavk
vgigpgsicttrivagvgvpqitavamvadraqeyglyviadggirysgdivkaiaagad
avmlgnllagtkeapgkeviingrkykqyrgmgslgammkggaeryyqggymktrkfvpe
gvegvvpyrgtvsevlyqlvgglkagmgyvgarnirelkekgefviithagikeshphdi
iitnea

Sequence, based on observed residues (ATOM records): (download)

>d2cu0b1 c.1.5.1 (B:3-95,B:207-478) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]}
kfveklekaikgytfddvllipqatevepkdvdvstritpnvklnipilsaamdtvtewe
mavamaregglgvihrnmgieeqveqvkrvkraXkyknavrdengellvaaavspfdikr
aieldkagvdvivvdtahahnlkaiksmkemrqkvdadfivgnianpkavddltfadavk
vgigpgsicttrivagvgvpqitavamvadraqeyglyviadggirysgdivkaiaagad
avmlgnllagtkeapgkeviingrkykqyrgmgslgammkymktrkfvpegvegvvpyrg
tvsevlyqlvgglkagmgyvgarnirelkekgefviithagikeshphdiiitnea

SCOPe Domain Coordinates for d2cu0b1:

Click to download the PDB-style file with coordinates for d2cu0b1.
(The format of our PDB-style files is described here.)

Timeline for d2cu0b1: