Lineage for d2csbb4 (2csb B:410-464)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001286Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2001323Family a.60.2.4: Topoisomerase V repeat domain [140626] (1 protein)
    this is a repeat family; one repeat unit is 2csb A:351-409 found in domain
  6. 2001324Protein Topoisomerase V [140627] (1 species)
  7. 2001325Species Methanopyrus kandleri [TaxId:2320] [140628] (2 PDB entries)
    Uniprot Q977W1 294-350! Uniprot Q977W1 351-409! Uniprot Q977W1 410-464! Uniprot Q977W1 465-519
  8. 2001332Domain d2csbb4: 2csb B:410-464 [197843]
    Other proteins in same PDB: d2csba5, d2csbb1
    automated match to d2csba3
    complexed with mg

Details for d2csbb4

PDB Entry: 2csb (more details), 2.3 Å

PDB Description: crystal structure of topoisomerase v from methanopyrus kandleri (61 kda fragment)
PDB Compounds: (B:) Topoisomerase V

SCOPe Domain Sequences for d2csbb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csbb4 a.60.2.4 (B:410-464) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]}
laeltkkegvgrktaerllrafgnpervkqlarefeieklasvegvgervlrslv

SCOPe Domain Coordinates for d2csbb4:

Click to download the PDB-style file with coordinates for d2csbb4.
(The format of our PDB-style files is described here.)

Timeline for d2csbb4: