SCOPe 2.05: Domain d2csbb4: 2csb B:410-464

Lineage for d2csbb4 (2csb B:410-464)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.4: Topoisomerase V repeat domain [140626] (1 protein)
   this is a repeat family; one repeat unit is 2csb A:351-409 found in domain

6. Protein Topoisomerase V [140627] (1 species)

7. Species Methanopyrus kandleri [TaxId:2320] [140628] (2 PDB entries)
   Uniprot Q977W1 294-350! Uniprot Q977W1 351-409! Uniprot Q977W1 410-464! Uniprot Q977W1 465-519

8. Domain d2csbb4: 2csb B:410-464 [197843]
   Other proteins in same PDB: d2csba5, d2csbb1
   automated match to d2csba3
   complexed with mg

Details for d2csbb4

PDB Entry: 2csb, 2.3 Å

PDB Description: crystal structure of topoisomerase v from methanopyrus kandleri (61 kda fragment)

PDB Compounds: (B:) Topoisomerase V

SCOPe Domain Sequences for d2csbb4:

Sequence; same for both SEQRES and ATOM records:

>d2csbb4 a.60.2.4 (B:410-464) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]}
laeltkkegvgrktaerllrafgnpervkqlarefeieklasvegvgervlrslv

Timeline for d2csbb4:

• d2csbb4 first appeared in SCOPe 2.03
  
• d2csbb4 appears in SCOPe 2.04
  
• d2csbb4 appears in SCOPe 2.06
  
• d2csbb4 appears in the current release, SCOPe 2.08