![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
![]() | Family a.60.2.4: Topoisomerase V repeat domain [140626] (1 protein) this is a repeat family; one repeat unit is 2csb A:351-409 found in domain |
![]() | Protein Topoisomerase V [140627] (1 species) |
![]() | Species Methanopyrus kandleri [TaxId:2320] [140628] (2 PDB entries) Uniprot Q977W1 294-350! Uniprot Q977W1 351-409! Uniprot Q977W1 410-464! Uniprot Q977W1 465-519 |
![]() | Domain d2csbb3: 2csb B:351-409 [197842] Other proteins in same PDB: d2csba5, d2csbb1 automated match to d2csba1 complexed with mg |
PDB Entry: 2csb (more details), 2.3 Å
SCOPe Domain Sequences for d2csbb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csbb3 a.60.2.4 (B:351-409) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]} rtlatlidehglspdaadeliehfesiagilatdleeiermyeegrlseeayraaveiq
Timeline for d2csbb3: