Lineage for d2ckfe2 (2ckf E:153-453)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192501Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2192753Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2193064Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2193065Protein automated matches [190218] (22 species)
    not a true protein
  7. 2193221Species Sphingomonas sp. [TaxId:279135] [225202] (1 PDB entry)
  8. 2193224Domain d2ckfe2: 2ckf E:153-453 [197839]
    Other proteins in same PDB: d2ckfa1, d2ckfb_, d2ckfc1, d2ckfd_, d2ckfe1, d2ckff_
    automated match to d1eg9a2
    complexed with fe, fes

Details for d2ckfe2

PDB Entry: 2ckf (more details), 1.85 Å

PDB Description: crystal structure of the terminal component of the pah-hydroxylating dioxygenase from sphingomonas sp chy-1
PDB Compounds: (E:) ring-hydroxylating dioxygenase alpha subunit

SCOPe Domain Sequences for d2ckfe2:

Sequence, based on SEQRES records: (download)

>d2ckfe2 d.129.3.0 (E:153-453) automated matches {Sphingomonas sp. [TaxId: 279135]}
eapsledylgefrfyldtiwegggaglellgppmksllhcnwkvpvenfvgdgyhvgwth
aaalgqiggplaglagnradipfddlglqfttrhghgfgvidnaaaaihrkgdgwnkyle
dtrgevrrkfgadrerlyvghwngaifpncsflygtntfkiwhprgpheievwtytmvps
dadpatksaiqreatrtfgtagtlesddgenmssatyvnrgvitrdgmmnstmgvgyegp
hpvypgivgisfigetsyrgfyrfwkemidapdwasvkanddnwdsvftnrnfwneklna
a

Sequence, based on observed residues (ATOM records): (download)

>d2ckfe2 d.129.3.0 (E:153-453) automated matches {Sphingomonas sp. [TaxId: 279135]}
eapsledylgefrfyldtiwegggaglellgppmksllhcnwkvpvenfvgdgyhvgwth
aaalgqglqfttrhghgfgvidnaaaaihrkgdgwnkyledtrgevrrkfgadrerlyvg
hwngaifpncsflygtntfkiwhprgpheievwtytmvpsdadpatksaiqreatrtfgt
agtlesddgenmssatyvnrgvitrdgmmnstmgvgyegphpvypgivgisfigetsyrg
fyrfwkemidapdwasvkanddnwdsvftnrnfwneklnaa

SCOPe Domain Coordinates for d2ckfe2:

Click to download the PDB-style file with coordinates for d2ckfe2.
(The format of our PDB-style files is described here.)

Timeline for d2ckfe2: