SCOPe 2.08: Domain d2ckfe1: 2ckf E:1-152

Lineage for d2ckfe1 (2ckf E:1-152)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Sphingomonas sp. [TaxId:279135] [225201] (1 PDB entry)

8. Domain d2ckfe1: 2ckf E:1-152 [197838]
   Other proteins in same PDB: d2ckfa2, d2ckfb_, d2ckfc2, d2ckfd_, d2ckfe2, d2ckff_
   automated match to d1o7na1
   complexed with fe, fes

Details for d2ckfe1

PDB Entry: 2ckf, 1.85 Å

PDB Description: crystal structure of the terminal component of the pah-hydroxylating dioxygenase from sphingomonas sp chy-1

PDB Compounds: (E:) ring-hydroxylating dioxygenase alpha subunit

SCOPe Domain Sequences for d2ckfe1:

Sequence; same for both SEQRES and ATOM records:

>d2ckfe1 b.33.1.0 (E:1-152) automated matches {Sphingomonas sp. [TaxId: 279135]}
msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae
dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples
rcyhnkldkqelaaksvrvetykgfifgchdp

Timeline for d2ckfe1:

• d2ckfe1 first appeared in SCOPe 2.03
  
• d2ckfe1 appears in SCOPe 2.07