SCOPe 2.08: Domain d2c1dg2: 2c1d G:180-290

Lineage for d2c1dg2 (2c1d G:180-290)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:266] [225029] (1 PDB entry)

8. Domain d2c1dg2: 2c1d G:180-290 [197832]
   automated match to d1h32a2
   complexed with hec, zn

Details for d2c1dg2

PDB Entry: 2c1d, 1.92 Å

PDB Description: crystal structure of soxxa from p. pantotrophus

PDB Compounds: (G:) soxa

SCOPe Domain Sequences for d2c1dg2:

Sequence; same for both SEQRES and ATOM records:

>d2c1dg2 a.3.1.0 (G:180-290) automated matches {Paracoccus denitrificans [TaxId: 266]}
idgpaapywehgkeiyytrygqlemscanchednagnmiradhlsqgqingfptyrlkds
gmvtaqhrfvgcvrdtraetfkagsddfkalelyvasrgnglsvegvsvrh

Timeline for d2c1dg2:

• d2c1dg2 first appeared in SCOPe 2.03
  
• d2c1dg2 appears in SCOPe 2.07