![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:266] [225029] (1 PDB entry) |
![]() | Domain d2c1dg1: 2c1d G:27-179 [197831] automated match to d1h32a1 complexed with hec, zn |
PDB Entry: 2c1d (more details), 1.92 Å
SCOPe Domain Sequences for d2c1dg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1dg1 a.3.1.0 (G:27-179) automated matches {Paracoccus denitrificans [TaxId: 266]} dpvedglvietdsgpveivtktappafladtfdtiysgwhfrddstrdlerddfdnpamv fvdrgldkwnaamgvngescaschqgpesmaglravmprvdehtgklmimedyvnacvte rmglekwgvtsdnmkdmlslislqsrgmavnvk
Timeline for d2c1dg1: